SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338307|ref|YP_001519484.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158338307|ref|YP_001519484.1|
Domain Number - Region: 86-166
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.0222
Family Leukotriene A4 hydrolase N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158338307|ref|YP_001519484.1|
Sequence length 192
Comment hypothetical protein AM1_5203 [Acaryochloris marina MBIC11017]
Sequence
MPPLISNQVVAWGANLATTVLLGSLLQTSVQAIELADGTTYFANVPRLENARTTYNSARV
FGATYYFTLHVPEDAGEPLQRVMFNQQEGVDSISFNLKRTQAYRNKQKKQLLPIAAASTD
EKGAISIFFDPPISPGETVTIGLRPYRNPRSSGVYLFGVTAFPQGEQAYGQFLGYGRLHF
YDHFRWPSYWGH
Download sequence
Identical sequences B0C9L7
WP_012165426.1.67183 gi|158338307|ref|YP_001519484.1| 329726.AM1_5203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]