SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338332|ref|YP_001519509.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338332|ref|YP_001519509.1|
Domain Number 1 Region: 409-508
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 8.37e-27
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 572-649
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.07e-25
Family DEP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 340-406
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 6.87e-18
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.001
Further Details:      
 
Domain Number 4 Region: 255-339
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000968
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158338332|ref|YP_001519509.1|
Sequence length 652
Comment mechanosensitive ion channel [Acaryochloris marina MBIC11017]
Sequence
MPISEMLYRRPFRPVQGFLILLFSLTLFLTGFSLPSRAEITIGRSFDTAPIVLDGKVLFQ
VSKLREFSAKDRAKQANDSLAQAIRDFAAAQDSPGVPTVKVTPGALPTLRLADRHLLTVT
DRDVMLGQDAMEQAVGWQRTINRAIATGLKERTPSYRRQAILKSGLGVLLAILLHCGIQW
IRLRWRRQQLRTMQDTKRPLALLGLTSLQLLVWVGVGYYICELFPQFRTLLYLVLRSFDE
PILILKEQEQGYGIVDLLIVVGLILGLWVIVRGLTLLLKSRILPLLGVNRGLQDAIAILT
QYVLTGLGVVVILQVLGVDIGALLIVGSALGLGIGFGLQNIVSNFISGIILLLDRPIEAG
DFIKVGELVGSVEKIGTRSTELRTHDEVTIIVPNSHFLEKEVVNWSHSSPVSRLHLPVDV
AYGCDVDRVQTALIESVSHHPEVLAHPQPQVQFLGFGESALNFEVLVWFREPRQQYRLKS
DLYFRIEAMLRQYQIEIPFPQRDLHVRSPHLEQLIDLLVQQRTENAPHLYYPDSVRSQPP
SQPILASPPPSPQPISRPSAPQINLPELVAQMKGEQGLDIQDRRHRLNIYPQCFVGSEAV
IWLMRTQRATRKEALRIGRLLMRKRIIHHVLDEHPFDDAYLFYRFYADEQQE
Download sequence
Identical sequences B0C9P2
329726.AM1_5228 gi|158338332|ref|YP_001519509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]