SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338439|ref|YP_001519616.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338439|ref|YP_001519616.1|
Domain Number 1 Region: 13-202
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 3.53e-56
Family Oxidoreductase molybdopterin-binding domain 0.0000887
Further Details:      
 
Domain Number 2 Region: 209-291
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000091
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158338439|ref|YP_001519616.1|
Sequence length 317
Comment molybdopterin-binding oxidoreductase [Acaryochloris marina MBIC11017]
Sequence
MFSADLRQFERPLPDHRITPVGEFYVQSYASPPDVDLNTWQLQLTGLVEQPLPLKFDDIL
AAPQTEFYLTMECIGNRTGGKQIGNALWTGTPLSPFLKQVGVQDKAVEFLLHAADSYETT
LPVIDLMRPDVQLVHRMNGEPLTKAHGFPVRIIIPGRYGQKQPKWLTEIEAIATPKKGYW
ERQGWSNTAKIATHAITQQVQEEKVWNKNYHVDLPRTGEEGWQRGVTVAGVAIDQAQPME
WVRISTDNGQTWTEAEINQPSSPHEWTLWRYLWKPTQPGTYKLLAQARSRTETQKIQDKN
GKDGSAGILKISVNLDS
Download sequence
Identical sequences B0CAU6
gi|158338439|ref|YP_001519616.1| 329726.AM1_5339 WP_012165546.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]