SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338458|ref|YP_001519635.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338458|ref|YP_001519635.1|
Domain Number 1 Region: 431-687
Classification Level Classification E-value
Superfamily PP2C-like 1.96e-50
Family PP2C-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338458|ref|YP_001519635.1|
Sequence length 699
Comment putative protein serine/threonine phosphatase [Acaryochloris marina MBIC11017]
Sequence
MIKCPQCNYHNIDDHRFCQQCGTSLTQKHCANCGHLVDFEVTHCPQCDHLTGTIWWTLIT
PLPNLDPSPTMAELSAVETIPMGESVALLDEEPSTEELLDSIERLVGDQSDGEIDTVELS
SSGSSTAVLQQSSDSKIPSLSPAIQSFLDQNPRYQLLASMVPQDPKLAENGNLELTILDT
QPLQVSPLAIMLNQLEGTINPADMGQPETIKGFLEAQPLPFPIVLEPYLALRQQFPLLLP
HVHDAWQSEQQAVILLENRADLPSLKEVIAEGQASPTQILYWLEQTLNFAVVCAPWQCLP
SVLNKENLKVDQGQILCLQQLLFEPGQFWPGKSEKGSTSIQSPTWDDLRYVWLDLLQGLG
ASLLEQFQPLLDNLQSAENVTQAELLEYLNELSQRLPSLQPSITHTQAHQSSGAETGAAP
TLILPNQLVHLAAAGQTDDGRDRHHNEDYFAIDQRLQQICNPHQNHVSGQGLYILCDGMG
GHAGGEIASSLATETLTQYFQAHWQTEFPDTAIVKDAIYAANHALFQLNEEKAGNNRMGT
TLVMALVQDTHIQIAHVGDSRLYRLTHQSGLEQITVDHEVGQREIQRGTDPAVAYARPDA
YQLTQALGPRENEALEPDIQLLTASEDTLLLICSDGLTDNHLLEVHCDQYLLPMLNSQVT
LQQGVNELVMLANEHNGHDNITVIAILMRVQPQRSSQTY
Download sequence
Identical sequences B0CBR6
329726.AM1_5360 gi|158338458|ref|YP_001519635.1| WP_012165563.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]