SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338471|ref|YP_001519648.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338471|ref|YP_001519648.1|
Domain Number 1 Region: 6-367
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 3.14e-109
Family Dehydroquinate synthase, DHQS 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158338471|ref|YP_001519648.1|
Sequence length 372
Comment 3-dehydroquinate synthase [Acaryochloris marina MBIC11017]
Sequence
MQQTFIPVPLPQQPYQIAIASGGLTQLGSWLQDRSLQSVKLGQKVLVVSNPQIWKHYGEI
VQDSLAQAGFQVEHFLLPAGERYKTPRSIQKIYDYALDLKLERSSTLVALGGGVIGDMTG
FAAATWLRGINFVQVPTSLLAMVDASIGGKTGVNHPKGKNLIGAFYQPRLVLIDPDTLKT
LASREFRAGMAEVIKYGVIWDLELFEVLEGCDRTNQYRYMPPHILTEILTRSAQAKADVV
TQDEKEAGLRAILNYGHTIGHAIESLTGYRLFNHGEAVALGMVAAADIAVQLDWWSVEDA
QRQHQLIQKTGLPTELPADFAIEAVADVLLTDKKVKDGKVRFILPTQLGKIDITDQVPGQ
VIVSALKGMIGQ
Download sequence
Identical sequences B0CBS9
WP_012165574.1.67183 329726.AM1_5373 gi|158338471|ref|YP_001519648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]