SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338487|ref|YP_001519664.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338487|ref|YP_001519664.1|
Domain Number 1 Region: 92-221
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.77e-33
Family Pentapeptide repeats 0.00031
Further Details:      
 
Domain Number 2 Region: 368-455
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.02e-22
Family Pentapeptide repeats 0.0022
Further Details:      
 
Domain Number 3 Region: 255-342
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.62e-21
Family Pentapeptide repeats 0.0023
Further Details:      
 
Domain Number 4 Region: 31-94
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.29e-16
Family Pentapeptide repeats 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338487|ref|YP_001519664.1|
Sequence length 464
Comment pentapeptide repeat-containing protein [Acaryochloris marina MBIC11017]
Sequence
MVALTLLSQPVQAAKGDHVDQLKETRECADCQLDKAKLGGADLRNANLKGANLKEANLRG
AKLDGADLLRADLKQADLREANLSSAQLTLSNLEKSQLGAAILFRANLSQAQLTLSNLEN
AQLRDANLSQANLTEANLARANLGKAQLNQANLTTANLSQARLQNASLVGTQLINANLEG
ASLKGANLIGADLTGANLVNADLREAKLDDTTVIDPKWRNAWAIVNQKQIESPVSEEASE
SLAPEPSATEDPTAQGKNLSGVHWVGINLVGAELEEADLSQAYLFIVNLQDSNLRATNFS
NARLRYTDFRRANLTNSNLEGADLRYANLEGADLNLAKLHKSKINIKTVLADKWRQVWEL
VNQGGRELDLKTADLAQADLNQVDFFRAQLPQANLAQSILDGANLTEANLFRADLTGASL
KAATLKNANLAEANLENANIEGTNLDDAYLCGAIMPDGTTHSCP
Download sequence
Identical sequences B0CBU5
gi|158338487|ref|YP_001519664.1| WP_012165587.1.67183 329726.AM1_5389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]