SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338511|ref|YP_001519688.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338511|ref|YP_001519688.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 8.66e-106
Family BC ATP-binding domain-like 0.0000000125
Further Details:      
 
Domain Number 2 Region: 678-939
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-102
Family BC ATP-binding domain-like 0.000000219
Further Details:      
 
Domain Number 3 Region: 396-553
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 3.01e-54
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000507
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.3e-48
Family BC N-terminal domain-like 0.00000383
Further Details:      
 
Domain Number 5 Region: 554-677
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.75e-46
Family BC N-terminal domain-like 0.00000435
Further Details:      
 
Domain Number 6 Region: 943-1076
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 4.19e-37
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338511|ref|YP_001519688.1|
Sequence length 1080
Comment carbamoyl phosphate synthase large subunit [Acaryochloris marina MBIC11017]
Sequence
MSRREDLHKILLIGSGPIVIGQACEFDYSGTQACKALRDEGYEVVLINSNPATIMTDPET
AERIYIEPLTPELVEKVIAKERPDALLPTMGGQTALNLAVTLAKTGVLDQYNVELIGAKL
PAIEMAEDRKLFKEAMERIGLGVCPSGLAETMAESQQIAQEIGTYPLIVRPAFTLGGTGG
GIAYNQEEFEAIAQSGLDASPVSQILIEKSLIGWKEYELEVMRDLADNVVIICSIENIDP
MGVHTGDSITVAPAQTLTDKEYQRLRDASIKIIREIGVETGGSNIQFAVNPIDGEVIVIE
MNPRVSRSSALASKATGFPIAKFAAKLAVGYALSEIPNDITRKTPASFEPSIDYVVTKIP
RFAFEKFPGSEPALTTQMKSVGEAMAIGRTFQESFQKALRSLETGRFGWGCDQAENLPSL
EQIRASLRNPNPERIYTVRHALQAGLSVEEIYDITGIDPWFLWHFQDLLTTEEYLKQTNL
YDLTADLMWQIKQQGFSDPQIAFATQSNEDEVRNYRKQLGVVPAYKTVDTCAAEFEALTP
YYYSTYEQESEVLPSDRRKVMILGSGPNRIGQGIEFDYCCCHASYALQADDFETIMVNSN
PETVSTDYDTSDRLYFEPLTKEDVLNILEAENPEGIIIQFGGQTPLKLAVPLQTYLQGKP
DGPKIWGTSPDSIDIAEDRERFEQILHTLNITQPPNGIARSNQEATEVAQRIQYPVVVRP
SYVLGGRAMEIVYSDEELERYMTFAVQVEPDHPILIDKFLEDAIEVDVDAIADRTGEVVI
GGIMEHIEQAGVHSGDSACAIPTLSLGEETLATIREWSKQLAQQLNVIGLMNLQFAVQGE
QVYILEANPRASRTVPFVSKAIGLPLAQVAARLMSGQTLADLGIKEERIPQHISVKEAVL
PFAKFPGTDTILGPEMRSTGEAMGIDTDFGKAFAKSQFSAHQDLPQSGSVFVSMTDRDKQ
AVIPIARDLIELGFKLVATAGTQKVLEAEGFEVAPVLKLHEGRPNVLDLIKNRQVQLILN
TPSGSDAHADGRLIRRSALAYKIPLITTIAGAKATAAALRSLQSETMDVKAIQDYHLQMQ
Download sequence
Identical sequences B0CBW9
WP_012165611.1.67183 329726.AM1_5413 gi|158338511|ref|YP_001519688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]