SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338563|ref|YP_001519740.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338563|ref|YP_001519740.1|
Domain Number 1 Region: 73-237
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.18e-39
Family Pentapeptide repeats 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158338563|ref|YP_001519740.1|
Sequence length 310
Comment pentapeptide repeat-containing protein [Acaryochloris marina MBIC11017]
Sequence
MKQILSTAILTSLIGLVGYIPRVHSQTINLRKTIEDLSDLSQEDALKHLATTGACFGCNL
NSANLQRAYLGYANLNRVDLSRADLSSADLRSANLREANLSRANLIHAKLWKTDLSVANL
NGADLKHTNLTKADLGFSNLTESNLSNASIGDANLRAVNLSNANLSKASLLRTNLTFANF
TRADLSNANFMSTNLISANLTSTNLSNADLSNANLTRADLSKANFSNTKLNFAILFSTDL
RKTVNLTQSQLVGQNSSLICNTPLPPHINIDPNRDCNKLAAVLFYKIPEIFLTLEEAQEF
VKEHQEGKRD
Download sequence
Identical sequences B0CCX9
329726.AM1_5466 WP_012165658.1.67183 gi|158338563|ref|YP_001519740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]