SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338574|ref|YP_001519751.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158338574|ref|YP_001519751.1|
Domain Number - Region: 3-56
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000471
Family GSPII protein E N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158338574|ref|YP_001519751.1|
Sequence length 61
Comment hypothetical protein AM1_5477 [Acaryochloris marina MBIC11017]
Sequence
MNRQTRLIQYLQDELALPQDALSLATRFQDRTATQIPIILWQYGLVNIDQLGQIYDWLAS
V
Download sequence
Identical sequences B0CCZ0
gi|158338574|ref|YP_001519751.1| 329726.AM1_5477 WP_010472536.1.53659 WP_010472536.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]