SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338583|ref|YP_001519760.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338583|ref|YP_001519760.1|
Domain Number 1 Region: 1-234
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.67e-87
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0000248
Further Details:      
 
Domain Number 2 Region: 238-338
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 1.73e-24
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338583|ref|YP_001519760.1|
Sequence length 355
Comment DNA polymerase IV [Acaryochloris marina MBIC11017]
Sequence
MRKILHIDMDAFFASVEQRDNPRLRGKPVVVGGRPEQRGAVAAASYEARKYGIFSATPSR
VAATKCKDLIFVAPRFEVYRQVSQQIRAIFHQFTDLVEPVSLDEAYLDVTENKPEINSAM
AIAREIKGLIHQETHLTASAGVSINKFLAKMASGLDKPNGLSLVAPDQAEAFVQQLPIEK
FHGIGKVTAAKMHQLGIQTGAELRQWSEPSLVRQFGKVGHYYYGIARGIDERPVIANRIR
KSIGAERSFFPDISGLPVLMEELDAIAAQVHLRLAENQRSGHTLTLKVKYANYQQITRSR
TVDHPLYEVDEILVLGKELLQSHIDEQQAVRLLGLTLANLVDKDRSPKQLSIGFV
Download sequence
Identical sequences B0CCZ9
WP_012165676.1.67183 329726.AM1_5486 gi|158338583|ref|YP_001519760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]