SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338672|ref|YP_001519849.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338672|ref|YP_001519849.1|
Domain Number 1 Region: 131-317
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.07e-49
Family ATP-binding domain of peptide synthetases 0.0000382
Further Details:      
 
Domain Number 2 Region: 1-129
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.6e-37
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158338672|ref|YP_001519849.1|
Sequence length 325
Comment glutathione synthetase [Acaryochloris marina MBIC11017]
Sequence
MKLAFIIDPISALDPGHDTSVALMESAQAAGYEVWITQFDQLSVLDGQAWATLTPVSLKP
VELIDGLWVATKDWFVLGDAQFQPLANMDAVWMRKDPPVTVSYLYTTYLLDYVNPQQTLL
INHPRGLRAANEKMYALQFQGAIPETIVSQDKSVILQFVQDKGMAVLKPLGGKAGEGILL
LQAEDRNLNSLIEISTRRGQEPVMVQVYLPEAQQGDKRIILLDGEPIGAVNRVPRGQEFR
GNMATGGRVVQAQITDQEKSICSQLGPVLKRDGLMFVGIDIIGGYLTEVNVTSPTGIREI
DRLDNTSLGEKVMHWLVTAKQGLLH
Download sequence
Identical sequences B0CE56
gi|158338672|ref|YP_001519849.1| WP_012165750.1.67183 329726.AM1_5576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]