SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338763|ref|YP_001519940.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338763|ref|YP_001519940.1|
Domain Number 1 Region: 61-166
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.09e-28
Family Pentapeptide repeats 0.0006
Further Details:      
 
Domain Number 2 Region: 181-288
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.15e-28
Family Pentapeptide repeats 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158338763|ref|YP_001519940.1|
Sequence length 299
Comment pentapeptide repeat-containing protein [Acaryochloris marina MBIC11017]
Sequence
MQTVLIWVDYMKQLNKGSLVIGTALASFSIAFLPLSAASNSAQTPNPEHLQQLQATNSCD
GCDLRGANLQDQNLKGASLQGANLQGANLQGVNLDDANLESANLKYANLSKATLRRASLT
TTLKQATNLQDANLTQATLVKTKLKGADLRRANLFEATLEDADFSVAVVETTQGIRRVYF
SDLREANFNKSNLKNATLNQVYLSNANLSEANLKGAKLKQAQLKYTNLNGAKLNNADLRK
ASLESVNLSEADLSSAHLGKIAMKDVNLRGANLSNADLSGAKLCQMDIPASLQALATCK
Download sequence
Identical sequences B0CG68
gi|158338763|ref|YP_001519940.1| 329726.AM1_5674 WP_012165839.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]