SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158338973|ref|YP_001520150.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158338973|ref|YP_001520150.1|
Domain Number 1 Region: 22-204
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.02e-50
Family Methylesterase CheB, C-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 291-481
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.66e-39
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00055
Further Details:      
 
Domain Number 3 Region: 1334-1494
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.26e-37
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 4 Region: 977-1104
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.67e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 5 Region: 1133-1254
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.74e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.028
Further Details:      
 
Domain Number 6 Region: 1262-1342
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.55e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 
Domain Number 7 Region: 854-978
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000314
Family Heme-binding PAS domain 0.074
Further Details:      
 
Domain Number 8 Region: 224-293
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000222
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.014
Further Details:      
 
Domain Number 9 Region: 719-838
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000141
Family Heme-binding PAS domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158338973|ref|YP_001520150.1|
Sequence length 1502
Comment chemotaxis response regulator [Acaryochloris marina MBIC11017]
Sequence
MNSNDHPSLNADSNTLNTIAPSFYVVAVGASAGGLKPLEVFFENIIPDSGVAFVVIQHLS
PDFKSLMNEILGRRTQMGIQIAEEGMALQPNSIYLIPAGQNMIVRDRCLYLYRQKRDQKP
NFPINLFFQSLADDIQERAIGIVLSGTGSDGTHGLQHIHESGGITLVQDPNTAEFDGMPH
TAISTGCIDYVEAPKVLAQMVNDLGNPAIVPADLVKFSSNLGAEAHQLQKIVELLAKHED
IDFSQYKPSTLGRRVERRRLLTQNNSLNDYASLLTESADERSLLRRDLLINVTQFFRDEK
VWEYLKDKVLRPIIADFPAAETLRIWVTACATGQEAYSMAIIVRELCEELGRQMPIKLFA
TDIDQTALDKAALGSFDESIADYVSVDRLQKYFTYNNGHFTIKRTLREMLIFSPHDLTKN
ASLTRMNVVCCRNVLIYMQPTLQQYVLRNLHFSLNKGGVLLLGTSEDLGELEPEFEVLHS
KNKIFSKFRDQRLNLNYFRTKTIATPVVSGRDPRYRRQADPLTENAFKAHLEELNMTCLL
LDTDEKLLRVCADHLDILRIPEGPATENVRSLLPEVMHLPFISAMSRVLREKQPVQFSSL
LWEHKDGPLDLRFKVSPCQSNCRESMFLRLEISASSRNSPPAQDQAVESSTEVINRIEQL
ELELSYTRENLQATIEELESTNEEQQATNEELIASNEELQSTNEELHAVNEELYTVNNEH
QSKIQELTALSNDIDNLFRSTEIGVVFLDQSLQVRKFTPAANQIFQFLPTDVGRPIRNLA
INVNYPSLIEVLSETARTGKVTEQEINAHGQHLLIRIHPYVDNDNEQQGVVMSIIDITAT
RKVQIELQSQRIKAKLAQDTLEVFQERYQQLYHETPVMMYSLDARGVIIEVSNFWLSKLG
YPRNMTLGATVDIFLNLESQKRFQKLWPRFLESGLSIDIPMQIQTKSGEIIDVLQSMIAE
RDDLGEVSRCLVVSVDISQRKLAEAARLESEQRFRSMADHAPVMIWLTEAPGHCTYLNQE
WLRFTGDSLEQALERGWQDRIHPEDLEESVAAYQQAVTERQPLRLEYRRCDRNGTYCWIL
DTAKPRFLPTGEFAGMIGSCIDISLQKQAEAALELSNLNLEADLAEKDASLHTIEGNLQE
SEARFYSLADNAPVLIWLSDAQGNCTYVNQTWENLTGQSLESQLGDGWLETIHPEDRDRV
KTLFQESCAQQCPFEQEFRQARADGVYRWILATGVPRIAADQFAGLICSCMDISDIKHSQ
KRLEQAIQELQRSNQELEQFAYIASHDLREPLRKIQSFAELLQDDLSTKLDQDQSRYFGY
IMSGAQRMQCLIQDVLQYSRVGRSDQPLELIDLKHVIEIVQSDLSLAIEESQAVIEFDSL
PSIHAHTVEITQVFENLINNAIKFRSSTPPRIQISAEQQPESWTILVKDNGIGIPEDSLE
RVFVMFQRLHYSNQYPGTGIGLALCRKVIESYGGTLTCTSAPGKGATFILQFPLQPVVPI
LQ
Download sequence
Identical sequences B0C1J7
WP_012166037.1.67183 329726.AM1_5892 gi|158338973|ref|YP_001520150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]