SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339007|ref|YP_001520184.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339007|ref|YP_001520184.1|
Domain Number 1 Region: 12-80
Classification Level Classification E-value
Superfamily CheY-like 6.4e-23
Family CheY-related 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158339007|ref|YP_001520184.1|
Sequence length 83
Comment hypothetical protein AM1_5925 [Acaryochloris marina MBIC11017]
Sequence
MTTLPNKTLKSNILVVDDSAENLRILSSMLTEEGFAVRCARSGLMALTTLQNTRADLILL
DIKMPQMSGYEVCEHLKADPVIL
Download sequence
Identical sequences B0C1N1
gi|158339007|ref|YP_001520184.1| WP_012166068.1.67183 329726.AM1_5925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]