SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339054|ref|YP_001520231.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339054|ref|YP_001520231.1|
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily CheY-like 8.68e-36
Family CheY-related 0.0037
Further Details:      
 
Domain Number 2 Region: 126-250
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.44e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.095
Further Details:      
 
Domain Number 3 Region: 257-437
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000305
Family GAF domain 0.016
Further Details:      
 
Weak hits

Sequence:  gi|158339054|ref|YP_001520231.1|
Domain Number - Region: 473-669
Classification Level Classification E-value
Superfamily PP2C-like 0.0112
Family PP2C-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158339054|ref|YP_001520231.1|
Sequence length 697
Comment two-component response regulator [Acaryochloris marina MBIC11017]
Sequence
MENRTPLILVVDDDRSTRIILRLILEQDGCEVVDVENGQQCLNAYLTRKPDMVLLDAKMP
VMDGFTCCAELQKLPLGASTPILMIAGLDDQASVDKAFAAGAMDYVTKPIHPPILRRRLR
HLLEASWAEQAVRDSEARYRSVVDHLKEVIFQINQEGNLAFLNPVWSELTGFVREEAINH
RLAEYVHPGDRQQFNQYIDQLFHRERSECRFDVRFLHQAGSFGWMEVYACAIPGPDGKIV
GISGSLADVTERKYQDQRLSVERATTRVLAEVATLSEAVPNLLQAISKSLGWEYGELWLM
DETNNTLKCVESWFELEEKMGSFQIASSSANFALASGLIQRIWTHDGPLWLTDNAIQDIH
ANSFPQAGMQTAFSFPILEGYNRLGVMVFSKREHQAMDASLLKIMGSIGTQLGEFIMRKR
AEEEVQHQHAKLQSELDQAAGYVRSLIPPPMTGPVSIQHQFIPSNQLGGDVFDYYWLDSD
HLAIYLLDVAGHGIRSTLLSVSVLNVVRSQSLLDTDFYQPSSVLDGLNEVFQMNEQGDDY
FTIWYGVYNCKTQKLKYASGGHPAVLLASAQNPIQPLEVRSIPIGMMTGFPYDQFECDIQ
TGSALYLFSDGVYEIVQPNGEVWTFDGFMTVVSEYQRRQFDTLDPLFQQIQHIAGNKSFE
DDYSLMKISFDSVQPKQTLPPIPYAAQAATPIAANPF
Download sequence
Identical sequences B0C2M4
gi|158339054|ref|YP_001520231.1| 329726.AM1_5976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]