SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339055|ref|YP_001520232.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339055|ref|YP_001520232.1|
Domain Number 1 Region: 18-189
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.54e-23
Family MJ1460-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158339055|ref|YP_001520232.1|
Sequence length 208
Comment V4R domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MISTQLNETSLSLNGEGTIDQLPSVLAMQRFHALNDQRNGSLTQKMQISSTSLKMLNRIV
EKFPAQEIYQIGKELGEREFRAFYLAFAPVNPSLLDLGWKTILERWWVYAYLSEYGNVNL
ELSQEQNDYFFVTFTNTKIHRTKATKNKPVCPLIAGVLAGFFSSLSGYEYEAIETECHEK
GHQNCTFILGNSGLVNSETFWQAIHDIH
Download sequence
Identical sequences B0C2M5
gi|158339055|ref|YP_001520232.1| 329726.AM1_5977 WP_012166115.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]