SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339075|ref|YP_001520252.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339075|ref|YP_001520252.1|
Domain Number 1 Region: 75-148
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000034
Family GSPII protein E N-terminal domain-like 0.034
Further Details:      
 
Weak hits

Sequence:  gi|158339075|ref|YP_001520252.1|
Domain Number - Region: 11-78
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000154
Family GSPII protein E N-terminal domain-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158339075|ref|YP_001520252.1|
Sequence length 188
Comment hypothetical protein AM1_6001 [Acaryochloris marina MBIC11017]
Sequence
MTIGPTLIQNSHKIGERLCASDLITPHQLETALYEQRLYEMMRLGEILTLHGWVQQQTAD
FFGDQWPYPDTQAEPVPIGSYFRRAGLIDRNMVDAILAAQKKTGLRFGALAVLNGYIRQA
TLDFFVEQFYPEHIGEPPYMIIDPDSLTDVSVNPFIQFDPNEEMPSASEANQANESPPTS
DNGVHWLD
Download sequence
Identical sequences B0C2P5
WP_012166135.1.67183 329726.AM1_6001 gi|158339075|ref|YP_001520252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]