SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339262|ref|YP_001520439.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158339262|ref|YP_001520439.1|
Domain Number - Region: 72-91
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0212
Family Intron-encoded homing endonucleases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339262|ref|YP_001520439.1|
Sequence length 128
Comment hypothetical protein AM1_6188 [Acaryochloris marina MBIC11017]
Sequence
MPMIRARYPDNWDEIALQVKDAADWCCTECGKPCRKPGVEWLHFSFWLMITHPEWFPITS
EREEQKPQRFTLTVAHLDQDPQNNHPDNLKALCAPCHLKFDAPFRKANAFTKREWFGQMK
LEDLTNET
Download sequence
Identical sequences B0C4Y2
gi|158339262|ref|YP_001520439.1| WP_012166309.1.67183 329726.AM1_6188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]