SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339360|ref|YP_001520537.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158339360|ref|YP_001520537.1|
Domain Number - Region: 35-241
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000392
Family LacY-like proton/sugar symporter 0.078
Further Details:      
 
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00801
Family Rubredoxin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339360|ref|YP_001520537.1|
Sequence length 253
Comment hypothetical protein AM1_6288 [Acaryochloris marina MBIC11017]
Sequence
MKFHCTYCGYKIETSNGQSGQLMTCPSCSADILVPPPPISELSAKSNANPKKSDSLPTQG
FVYRRLFLISLIGCLIFGALTAIYSLITSSFDTSQATILLTTVSLGTYSMTGLCCSTLIG
HPQHNRFGQIGIAVSVFSGFWAFVNNLAILANQEINNWGELLQVRFSFLVVAVAFAHCSL
LLRIHTTNKTVQNVRYVTLGIIAMFSMVLLGNIMAPDNFSTSWKLISILSVLNVLGTIAT
PLYHAATKESKAN
Download sequence
Identical sequences B0C7D4
WP_012166397.1.67183 329726.AM1_6288 gi|158339360|ref|YP_001520537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]