SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339487|ref|YP_001518034.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339487|ref|YP_001518034.1|
Domain Number 1 Region: 1-31
Classification Level Classification E-value
Superfamily Subunit XII of photosystem I reaction centre, PsaM 0.00000000837
Family Subunit XII of photosystem I reaction centre, PsaM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158339487|ref|YP_001518034.1|
Sequence length 31
Comment photosystem I PsaM subunit [Acaryochloris marina MBIC11017]
Sequence
MELSDLQIVIALVVALLPALLALNLGSALSK
Download sequence
Identical sequences B0C4H4
WP_010468637.1.53659 WP_010468637.1.67183 gi|158339487|ref|YP_001518034.1| 329726.AM1_6426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]