SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339515|ref|YP_001520904.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339515|ref|YP_001520904.1|
Domain Number 1 Region: 21-113
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.1e-21
Family ParB-like nuclease domain 0.0019
Further Details:      
 
Domain Number 2 Region: 104-132,166-246
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 3.79e-16
Family KorB DNA-binding domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339515|ref|YP_001520904.1|
Sequence length 302
Comment ParB family chromosome partitioning protein [Acaryochloris marina MBIC11017]
Sequence
MYGSSLESLDNDVDQESDKIAVIPIDKIKRTPDQVRRYFDPMKMNQLVSSVRIDGILENL
IVSSLNDGKFQLISGERRLRAAKEVGLTEVPVKILNLDEFDAFRISLIENLQREDLNPVE
ETDGIIKLLAGELHLREDEVVSLLYQMQNSLTRQVVNHNVVVQENQETVEKIFNYLGRLS
WQSFVKHRLPLRKLPVDILEFLRQGKLAYTKAQLIARIKDQEFRKEMLNVAVTEELSLSE
IRTRISEFAQKEISNNPDIDTELRKKTAGCLKALKKSKAINSPTKQKKLRKILEQLEKLL
ES
Download sequence
Identical sequences A8ZKQ4
gi|158339515|ref|YP_001520904.1|NC_009926 329726.AM1_A0252 WP_012166750.1.67183 gi|158339515|ref|YP_001520904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]