SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339687|ref|YP_001520694.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158339687|ref|YP_001520694.1|
Domain Number - Region: 66-151
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000497
Family Bifunctional DNA primase/polymerase N-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339687|ref|YP_001520694.1|
Sequence length 679
Comment hypothetical protein AM1_A0035 [Acaryochloris marina MBIC11017]
Sequence
MLQRQHGSPSHVPDYVFQHPRRPKHDPLPADPLGQRLALLFPNGWDWIFASVPEQGNPVD
WETVKKFPLSPVELWSLHQDPDCLIGVRPNAQTRWLVLDIDKDSRYHPTSAPHWLPKIRH
ALEEIGICRSLLCQSSHSGGLHLYLPLPESVSSFWLSVCIKLNLEAEGVKFCGGQCELYP
NPKRYVPKGKGYSLFAAFRLPMQPGSGFHPLDTDLNPLPWFLEDWLDCFELCADGQDMGR
LHHAIADAQQNFKVRKSGNASSLATWQERIHEEKSQGWTGPGQTNEKLKIIACEARVFLG
MDSSEQIAEYVCQTAQNTPGFNEHCRHQHEIERRSYEVATWTMRYYWPAGSAPARDAKYN
DKQVAPADFGYHQSKREAAQNRIKKAVFELRRVSKLPPGITARASAIAKLAHTSQKTLYR
KSNLELWHPHHLPPEPPQKALDPLQEGTITQLCSNNTHFLNQRKLELYLLKDLLQLYIYV
GFVIMTMRIQAAVALALKGQRAAKAALVNSEDLDRGGLGGNSKVIPIQNWDQLHLSLPPG
LQQKISKAKRQQQRELEYEQRRRQRVKARKSQRKALSEANAELRPQNQEQLPLQLITNGE
QPIEREARLSEREEFDHWYQLAMQCKLVADYSWRDGEYWVLAEEQWQPYTELSAVFTLRA
MERMFGVCLDLKGDTDGFP
Download sequence
Identical sequences A8ZK44
gi|158339687|ref|YP_001520694.1|NC_009926 gi|158339687|ref|YP_001520694.1| WP_012166547.1.67183 329726.AM1_A0035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]