SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339699|ref|YP_001520706.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339699|ref|YP_001520706.1|
Domain Number 1 Region: 446-549
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 7.32e-25
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 381-441
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000271
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|158339699|ref|YP_001520706.1|
Domain Number - Region: 305-377
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000209
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0085
Further Details:      
 
Domain Number - Region: 158-202
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0863
Family ABC transporter transmembrane region 0.027
Further Details:      
 
Domain Number - Region: 166-303
Classification Level Classification E-value
Superfamily SNF-like 0.0902
Family SNF-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339699|ref|YP_001520706.1|
Sequence length 555
Comment mechanosensitive ion channel, putative [Acaryochloris marina MBIC11017]
Sequence
MSYFWPSLAHAQFPSFSHLDTSSNRQPNIHYIQRGNMHIANVRLDGVSLFQVAAPTAIDD
PDSQSNILPIEWRVNEIETHLEKIVNSGIDPNALRVTASTLNNQEVIIAQGKDWKLPLMT
ITELDRQIDSTSYSISEIAKVKASKIKSALLEANRERQPEHLKQQLFYLLIILVAVIIIS
LILRYLQILLKHQWTQLNSKNIKNPSTTQNNDFPDGQTSIESYQETTIGHPIRKHLPKLS
LPQQKNINLTLRSLLWWSQVAIWLSFAIFALLLFPQTRQAGLWLVGVPVSFIGILLVLSI
SKKIIDILIVYGLHRWSENDAFNHTPNQRITLRTPTITNVLQEVTRYVVIIIGILMFLDA
IQAPLALVLTGIGIVGLSAQNLIKDFINGFLILWEDQYTKNDVVKINGIVGLVEYLNLRV
TQLRTLEGELVTIANGSFSTAINLTHQWSRINLGIEVAYSTDLDQAMAVIEEVAIKLQHD
PIWGVLINETPTILGVDAFGESSITIRILIKTQPMKHWDVGREYRRRLKQAFDQANITIP
FPQRSIWFEGYSVDT
Download sequence
Identical sequences A8ZK56
WP_012166559.1.67183 gi|158339699|ref|YP_001520706.1| gi|158339699|ref|YP_001520706.1|NC_009926 329726.AM1_A0047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]