SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339712|ref|YP_001520718.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339712|ref|YP_001520718.1|
Domain Number 1 Region: 82-142
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000000496
Family Double-stranded RNA-binding domain (dsRBD) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158339712|ref|YP_001520718.1|
Sequence length 157
Comment hypothetical protein AM1_A0060 [Acaryochloris marina MBIC11017]
Sequence
MPTPQPISSLTIHLTSEHLGFLAYLYPKEDPEDALIKLLDSARTRAIRRAEQQVRVLHLD
QEEPEAPEEDPEEPVNLSGDVVENPIGTLQELCQRQQISMPSYEFETIPEGFRCSVQAMG
LRGVGEGVSKKKAKMGAARKLLGRGCFGMDRESQQSE
Download sequence
Identical sequences A8ZK68
WP_012166570.1.67183 gi|158339712|ref|YP_001520718.1| 329726.AM1_A0060 gi|158339712|ref|YP_001520718.1|NC_009926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]