SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339720|ref|YP_001520727.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158339720|ref|YP_001520727.1|
Domain Number - Region: 15-39
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0408
Family Double-stranded RNA-binding domain (dsRBD) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158339720|ref|YP_001520727.1|
Sequence length 39
Comment hypothetical protein AM1_A0068 [Acaryochloris marina MBIC11017]
Sequence
MPRYGFEVIPKGGHCMVLEMRLWGAGKRRSKKQAKVGAA
Download sequence
Identical sequences A8ZK77
gi|158339720|ref|YP_001520727.1|NC_009926 329726.AM1_A0068 gi|158339720|ref|YP_001520727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]