SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339747|ref|YP_001520754.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339747|ref|YP_001520754.1|
Domain Number 1 Region: 138-474
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.85e-87
Family RNB domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 684-751
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000173
Family Double-stranded RNA-binding domain (dsRBD) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158339747|ref|YP_001520754.1|
Sequence length 767
Comment exoribonuclease II, putative [Acaryochloris marina MBIC11017]
Sequence
MPTATSEKLIQLRAQLQDCTNPTAAKILKSTIVKLEAQLSLGQAQTKVSKIDQRKATLKN
SNKQTKRKAVQQQPITLKPPSLNTVETKPKAEPQKERPTLPAHEKTLLADDVLTQNENIA
TQKSLESKSETSPKSKSRFSPDVIKVAKRLVLPDELWQRPQVQGITIDGPTSRDLDDAIW
IEATESGAVLSVHIADVSELVEMGSILDKVALSRTVTRYFSNGNAPMLPRPLSENKLSLL
EGEARPTVTVQVTLNPNAQMVDVKIFESWLVSQKRFTYAEASQPKSSTPFHNTLEMAHQW
ASHLYRNRLTSGSIGATQTAQGQWLTEEGSLIQGKLHPSHILIQEFMILANLAVAQWLAD
QDIPALYRNHTARAIAPDRETMYQTLLTLGSNAAIRQRLHSWMNRAVYSPVLIGHFALNL
PAYCHFTSPIRRVADLINHRIVKARLKHQGLPYTQSELVKLGQHIAQVKDEHKEQASEFF
KAAHQKVYQEQLQTPEDLANLSGKEFTRLLKYAVESQGVDHLRSELLTRLYAEQLAVQDL
YLLLFQSKELELHQQVIQYLSSHIHDAASVITIASNREGNWEAFKYLEAENKPPFHVWLE
VKISGDTLTTIHPATHSRKQPARHHACLIWIEAYLQTSLVSPEQRAQPVLPEPQFKSGNE
DIKRVTAPLSKSMHTALVKPLKEGQNFVGMLVDVCQTLRWETPVYTMDSSDEWFICECEL
SVLGQQLEGSGVAKKKKLAKSIAAREILEQLRERGQQQLQEWLERAT
Download sequence
Identical sequences A8ZKA4
gi|158339747|ref|YP_001520754.1|NC_009926 gi|158339747|ref|YP_001520754.1| 329726.AM1_A0095 WP_012166605.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]