SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158339759|ref|YP_001520766.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339759|ref|YP_001520766.1|
Domain Number 1 Region: 19-81
Classification Level Classification E-value
Superfamily Pili subunits 0.0000000432
Family Pilin 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158339759|ref|YP_001520766.1|
Sequence length 288
Comment type IV pilin protein, putative [Acaryochloris marina MBIC11017]
Sequence
MFHFNALIPLRSSPSNAGFTLPEKMVICCIIGIAAAASAPSLMASMNRAKVKQTMTEVQS
ALNETQREAIKGNKICTLTLNFVEEKITGPCLKSGDRTLDADVAIATNLTDPSSSETPDE
GQPVLIGSDVQPSLGLSDGETVSQIALAPVSEDEANISKAGVMVQVIAKCKGNTEKGLGL
GTCKNKNNSNPENGSNEPPSTPGTLTSIPIKYGVLGNPEFAIVSAQQTPTDPTGKIVFYN
PQDSQVTKRCIAISNTLGLTRIGTYQGDIKPTAITDSGRCTAENWEEQ
Download sequence
Identical sequences A8ZKB6
329726.AM1_A0107 gi|158339759|ref|YP_001520766.1|NC_009926 WP_012166617.1.67183 gi|158339759|ref|YP_001520766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]