SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339777|ref|YP_001520784.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339777|ref|YP_001520784.1|
Domain Number 1 Region: 32-450
Classification Level Classification E-value
Superfamily ADC synthase 5.89e-93
Family ADC synthase 0.00000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158339777|ref|YP_001520784.1|
Sequence length 459
Comment menaquinone-specific isochorismate synthase [Acaryochloris marina MBIC11017]
Sequence
MCLHRKIIDFIVDELKTLAENSQSKIVRLEVSIDHDIEPLHWLSQQKSIIKTYWSDRHDR
FEMAGIGSADLVFSREKASSHVLFKRLRKFLSCKYSCVRYYGGICFSQNQIASYPWQDFG
NHFFLVPKFEVFKDQAGTYLALNLLLHHSDNANKKIQQTLQELAAINFNLPHQQCEKPQL
SKRVDFPNQLQWYNNVNKGLTYLDQGILEKVVLARQTEFTIVDSCQPEHLLSLIQKEQNC
SFQFCFQLDRDKAFIGSTPERLYWRQSSQIQTEAIAGTRPRGASYQEDNNFAKELLSSPK
EIREHKLVLKGLQETLSTLCHQVNIAEDPNLLRLNQVQHLYSHCSGILNPEISDADIINQ
LHPTPAVGGYPRQKALELIASLETFSRGFYASPIGWVALDSAEFLVSIRSGLIQRNKLIL
FAGAGIISDSQPEAEWEELENKIRNFLQVVSCQASVDII
Download sequence
Identical sequences A8ZKD4
gi|158339777|ref|YP_001520784.1| gi|158339777|ref|YP_001520784.1|NC_009926 329726.AM1_A0125 WP_012166635.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]