SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339898|ref|YP_001521068.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339898|ref|YP_001521068.1|
Domain Number 1 Region: 120-151,185-263
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 6.41e-18
Family KorB DNA-binding domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 32-129
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.53e-17
Family ParB-like nuclease domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158339898|ref|YP_001521068.1|
Sequence length 316
Comment ParB family chromosome partitioning protein [Acaryochloris marina MBIC11017]
Sequence
MTRRTLKKAIQADNQLSDFVFGNVEVADGDLKYIPLNSIKRTTLQQRRYFDQKQIEEWAK
HEIKINGIRSPLWVRKLPKSNRKQEYELVAGERRYRAAEFLNLLEVPVRIFILDDRQALM
ASLVENMQRQDLSPLEETEGTLEFLSMELDLPIEKVTKFLYQMNNASKGTVNQNVLVSDN
AHKVENVFKVLGRLTWTSFVSSRLPLLKNPSDILNALRSGEIEYTKAMAISKLKDKKTRV
KILKKAINESLSLTEIKQLINSYREPVDQPTELSLDTEVKKALAKFKKSKVWTNPKKEKQ
IRRLLQQLDKLMDDDN
Download sequence
Identical sequences A8ZLY5
gi|158339898|ref|YP_001521068.1|NC_009927 gi|158339898|ref|YP_001521068.1| WP_012166908.1.67183 329726.AM1_B0028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]