SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158340251|ref|YP_001521421.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158340251|ref|YP_001521421.1|
Domain Number 1 Region: 635-975
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.49e-95
Family WD40-repeat 0.00000354
Further Details:      
 
Domain Number 2 Region: 956-1237
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.8e-91
Family WD40-repeat 0.00000764
Further Details:      
 
Domain Number 3 Region: 163-436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.67e-37
Family G proteins 0.03
Further Details:      
 
Domain Number 4 Region: 597-633
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000288
Family Pentapeptide repeats 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158340251|ref|YP_001521421.1|
Sequence length 1268
Comment WD repeat-containing protein [Acaryochloris marina MBIC11017]
Sequence
MARVSYGPTPRKRTKFLLEVILAYANDEFEIQDRLRSQILVNWQTDQQLVVETTIKDLAE
LSKKYPSNRELSKDQIKISLKLLEQFVDILTDNRSQPKGSNKWHFTLNFWYKRHNKVANL
KQFDEEWEQRRPFKSKQATDQKSSALPVNSFLANPDLQLDTRNRDWGSAIDVSWFYGRKT
ELTLLSQWLVDEHCRFIVVLGMGGMGKTALTIQLAQKVQYDFDFVIWRSLASAPPITEIL
SDLIQFLSNQQENYLPKGIESQISLLLSYLRTSRCLVILDNAESLLQSGDRTGRYRSGCE
DYAKLFEMFGEATHSSCVLVTAREKPQGIAAMEGDSLPVRCLQLKGLSTNACQTLVKTKG
IFTGTEKEWSAINKHYAGNPLALKIVSSTIKECFEGSLSRFLSFSQMEPFVLEDIYDLLN
KQFERLSEIEQAVMYWLTINREPAQLEQLALDLMVQVLPGDLLQSITSLQRRSLVDQTET
GFTQQPVVMEFTAHKFIQQICTEIQEQQQYEERQENQLHLFRTHALIKAQAKDYIKDTQI
RLILQPLIVSLVKVLGSRAHLEACLVQLLSVVRGKSSEEAGYVAGNVLNLLRQLPVDFCG
YDFSHLTIRQADLRGLNLHGVKFTHSDLSQSVFSKDFGGILSIAFSPDGKLIAAGDFKGE
IRLLRVPDGQPLLTCSGHTNWVKSLAFSPTNHLLASAGPDQTVRLWNVRTGECLKLLSGH
TNFIWEVAFSPDGTLLASCSDDFTVRLWNSQTGQFLKSFRYRAAARSIAFSPDNHELACG
YADQTIRIWEVKSGQCLKVLAGHAGWVWSIAYSPDGQMLVSACDDPIIRVWNLQSGECIQ
KLFGHSNSIRSIALCSSGHYLASGSADQLIKIWDIRTGKCLKTLLGHTNWVWSVAINPTQ
KIMASSSQDGSIRLWDYNKGRCLRTLSGCTFTIFEAIFATTPFGSFNYSETEKQHEQILV
SGGDAQVLRVWSLSDHNCLDFPGHTDAIRSVAYCPHDQIIASGGGTGDRTIRLWNISNGQ
CIKILKGHSNGIWSLAFHPKGKFLASSGLDQSAKLWDIHSGECLETFQGHGHWVWSVSFS
PNAEILASGSFDRTVKLWDIQEGRCLNTLKGHSSGVSSVSFSPNEHFIASGSVDQTARLW
DFKTNDCICIFEGHSGQIWDVAFSPNGQLLATASLDHTIRCWDVETHKHLAILEGHTNGV
TSVAFSSDGQRLISSSFDGTIKLWHVQTGECIRTLRPTKPYAGMNITQMKGLSPAQKHTL
LALGAVEN
Download sequence
Identical sequences A8ZLT0
gi|158340251|ref|YP_001521421.1| WP_012167250.1.67183 gi|158340251|ref|YP_001521421.1|NC_009927 329726.AM1_B0389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]