SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158340279|ref|YP_001521449.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158340279|ref|YP_001521449.1|
Domain Number 1 Region: 133-469
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.17e-87
Family RNB domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 677-748
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000104
Family Double-stranded RNA-binding domain (dsRBD) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158340279|ref|YP_001521449.1|
Sequence length 772
Comment exoribonuclease II [Acaryochloris marina MBIC11017]
Sequence
MPTATSEKLNQLRAQLQECTNPIAAKLLKSTIAKLEAQISSGQPKTTASKIAQRKAALRH
SQKQAKQKERSTLKPPSSKSEGVPQHKKPITLDQEKPIEQAKVTAVVQVEKSKPLIQDGP
QATTETTPKNKNRFSPDVIKIAKRLVLADELWERPQVQGITIDGPTSRDLDDAIWIEATE
SGVVLSVHIADVSELVEMGSILDKVALSRTVTRYFSNGNAPMLPRPLSENKLSLLEGEAR
PTVTVQVTLNPNAQMVDVKIFESWLVSHKRFTYAEASQPKSSTPFHNTLEMAHQWASHLY
RNRLTSGSIGATQTAQGQWLTEEGSLIQGKLHPSHILIQEFMILANLAVAQWLADQDIPA
LYRNHTARAIAPDRETMYQTLLMLGSNAAIRQRLHSWMNRAVYSPVLIGHFALNLPAYCH
FTSPIRRVADLINHRIVKACLKHQGLPYKQSELAELGQHIAQVKDEHKEQASEFFKAAHQ
KVYQEQLQTPEDLANLSGKEFTRLLKYAVESQGVDELRSELLTRLGAEQLAVQDLYLLLF
QSKELELQQQVIQYLSGHIYDAASVITIASNQERNWEAFNYLEAENSPPFHIWLEVIISG
DSLTTIHPATHSRKQPARHHACLIWLEDYLQKNLVNPEASVQPPLPEAKLSSKDSAPSAA
SLSKAMQTALMKPLSGGQNFVGMLVDICQTLRWENPEYEMGSSDDWFICKCELDVLGERL
EGSGVAKKKKLSKSLAAKEVLEQVRELAPQHWEEWFPGVAFSQPKNLTNQED
Download sequence
Identical sequences A8ZLV8
gi|158340279|ref|YP_001521449.1|NC_009927 WP_012167277.1.67183 gi|158340279|ref|YP_001521449.1| 329726.AM1_B0417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]