SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158340789|ref|YP_001521957.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158340789|ref|YP_001521957.1|
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily GroES-like 2.28e-54
Family Alcohol dehydrogenase-like, N-terminal domain 0.00004
Further Details:      
 
Domain Number 2 Region: 138-290
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.26e-20
Family Alcohol dehydrogenase-like, C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158340789|ref|YP_001521957.1|
Sequence length 336
Comment alcohol dehydrogenase, zinc-containing [Acaryochloris marina MBIC11017]
Sequence
MRAMQLDAPGQLLRLVERPIPTPNPHQLLLRIHICGVCRTDLHIVDGELPDPKLPLILGH
QIVGTVIELGEQVTGFKQGDRIGVPWLGRTCNCCRYCLSGRENLCDQARFMGYNLDGGFA
EYAVADAQFCFPIPEEYPDQQAAPLLCAGLIGYRSYRMVGKAERIGFYGFGAAAHILIQV
ANYQGRQIYAFTRPGDMQAQQFARELGAVWSGGSDESPPQSLDAAIIFAPVGSLVPAALT
AVTKAGVVVCAGIHMSDIPSFPYKSLWEERSIRSVANLTRQDGEEFLTLAPQIPIQTQVQ
AFPLSTANEALSALRNGKVTGAVALVMTDESGQKDF
Download sequence
Identical sequences A8ZNQ7
gi|158340789|ref|YP_001521957.1| 329726.AM1_D0148 gi|158340789|ref|YP_001521957.1|NC_009929 WP_012167729.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]