SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158340808|ref|YP_001521975.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158340808|ref|YP_001521975.1|
Domain Number 1 Region: 3-288
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 5.62e-54
Family ATP synthase (F1-ATPase), gamma subunit 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158340808|ref|YP_001521975.1|
Sequence length 292
Comment ATP synthase F1, gamma subunit [Acaryochloris marina MBIC11017]
Sequence
MQTLETLKRKIASTQELQTVAKTMKALAAANIRQYEQAANALQHYRQTLAMAIQILRINY
PDTLTHLRPRAHPRLGIVIFGSDQGMCGRFNEQLSEMVIQHLEQHSSQGGQPLLLGMGAR
ICDSIIDQGYAIERYLSVPASVDGITSKAQTIVVQLEQWRNQCQVDQIWVFHNQPIRGHT
STPHRQQLFPLESDRDRSSSWSTRCRPMVFLSRERLFSAIFRQHFFVALYQACAESLASE
NASRLTSMQLAQTNIAEHLMELQAAFQQQRQTKITEELLDIVSGFEALNQSH
Download sequence
Identical sequences A8ZNS5
gi|158340808|ref|YP_001521975.1|NC_009929 329726.AM1_D0167 gi|158340808|ref|YP_001521975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]