SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158341011|ref|YP_001522178.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158341011|ref|YP_001522178.1|
Domain Number 1 Region: 5-344
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.48e-86
Family RNB domain-like 0.0000652
Further Details:      
 
Domain Number 2 Region: 543-612
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000000126
Family Double-stranded RNA-binding domain (dsRBD) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158341011|ref|YP_001522178.1|
Sequence length 623
Comment exoribonuclease II [Acaryochloris marina MBIC11017]
Sequence
MPRKPFSKSVIEEAETIALHTSINQRPQVPGITIDGAHSRDLDDAIWIEEKEHLTTLSVH
IADVAELVQPGSLVDQEARSRIQTLYFRHNNTPMLPRCLSEDKLSLLEHQLRPTITLEIT
LNQSAEIQNVEVYESRLSSHKRFTYEQADEALMDISRPDSNFIYRCWQWAEQLYQRRIQS
KNFDGLTLPEGYYLDENGNLLSTDFARYQSYLIIQEFMILANTAMAQWLDQHNIPAIYRN
HMHRAIGPEQTHQFAALVNAQSEEDTRRVLMSWLNPAEYGPEPHGHFALNLSAYCHFTSP
IRRYPDLINHRMVKAHLKGQSYPYSIEDIQALSQHIEATIQAQEETHKTYCKAQQRQLYE
AQLQSPEIIAQLPQGEFSLLLRFALEDQQGENLKAEAETRLQSGNVTVEDLFVLLLLGDE
LQLQEQVLEYLGDHLYDAASIVSIALNQIEAWHSSAYVEVSQEPPFMTWLEILIGEQLWT
TAKPGISMNKTGAKHQACLAWLKAKFEGTLVHPEHREAPPIPQPSAPKPPPVIHKLRQYQ
EGHNCLSLLMELCQGLQWPQAEFEIVEHEQGFHCECRLKVDDEVIIGSGIASSKKTAKHR
AARPVVEQLQKTLAQDESLVAAC
Download sequence
Identical sequences A8ZPC8
gi|158341011|ref|YP_001522178.1|NC_009930 329726.AM1_E0095 WP_012167988.1.67183 gi|158341011|ref|YP_001522178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]