SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158341037|ref|YP_001522204.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158341037|ref|YP_001522204.1|
Domain Number - Region: 75-170
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0159
Family Retroviral integrase, catalytic domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158341037|ref|YP_001522204.1|
Sequence length 201
Comment hypothetical protein AM1_E0121 [Acaryochloris marina MBIC11017]
Sequence
MSWRRLRRVVAGQPDPVEYETKRHQLEVLKRQEEKGELDLRYLDESGFCLVPYVPYAWQE
KGETLGLPSQRSSRFNVLGLMNRHNDLTSYVFDKSITSAVVVACIDDFSRTCDQHTVVVM
DQASVHKNAEIEEKIEDWKAKNVEIFWLPTYSPHLNLIEIFWRFMKYEWIEFAAYKCLGS
LSLYIDKILKGFGKDYVIDFG
Download sequence
Identical sequences A8ZPF4
329726.AM1_E0121 gi|158341037|ref|YP_001522204.1|NC_009930 gi|158341037|ref|YP_001522204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]