SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158341094|ref|YP_001522261.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158341094|ref|YP_001522261.1|
Domain Number - Region: 50-238
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000249
Family LacY-like proton/sugar symporter 0.078
Further Details:      
 
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00801
Family Rubredoxin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158341094|ref|YP_001522261.1|
Sequence length 253
Comment hypothetical protein AM1_E0178 [Acaryochloris marina MBIC11017]
Sequence
MKFHCTYCGYKIETSNGQSGQLMTCPSCSADILVPPPPISELSAKSKANLKKSDSLPTQG
FVYRRLFLISLIGCLIFGALTAIYSLITSSFDTSQATILLTTVSLGTYSMTGLCCSTLIG
HPQHHRFGQIGIAVSVFSGFWAFVNNLAILANQEINNWGELLQVRFSFLVVAVAFAHCSL
LLRIHTTNQTVQNVRYVTLGIIAMFSMVLLGNIMAPDNFSTSWKLISILSVLNVLGTIAT
PLYHAATKESKAN
Download sequence
Identical sequences A8ZPL1
gi|158341094|ref|YP_001522261.1|NC_009930 329726.AM1_E0178 WP_012167911.1.67183 gi|158341094|ref|YP_001522261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]