SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158341201|ref|YP_001522435.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158341201|ref|YP_001522435.1|
Domain Number - Region: 68-148
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000405
Family Bifunctional DNA primase/polymerase N-terminal domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158341201|ref|YP_001522435.1|
Sequence length 673
Comment hypothetical protein AM1_F0131 [Acaryochloris marina MBIC11017]
Sequence
MNAEPVFYGHENKSRVPHRRTHDPLPADPVGQRLALLFPNGWDWIFASAPDPGNPVDWET
VKKFPLSPVEMWSHHQDPDCLIGVRPSAQTRWLVLDIDKDSRYHPSSDPEWLPKIRHALE
DIGICRSLLCQSSHSGGLHLYLPLPESVSSFWLSVCIKLNLEAEGIKFYGGQCELYPNPK
RYVPKGKGYSLFAAFRLPMQPGSGFHPLDADLNPLPWSLETWLEAFELCADGQDMGRLSH
AIADAQQNFKVRKSGNASSLATWQERIHEEKQQGWTGPCQTNEKLKIIACEARVFLGMDS
PEQIAEYVCQTAQNTPGFNEHCRHQHEIERRSYEVATWAMRYYWPAGSAPTRDAKYHDKQ
VAPADFGYHQSKREAAQNRIKQAVLELKRVDKLPPGIAARASAIAKLAHTSQKTLYRKSN
LELWHPHHLPPEPPQKAPEALQKGTITQLGSNNTHLLNQRKLELLLFRSFLQLYIYVGFV
IQTIRIQAAVALAPKGQRAAKAALESSEDLDRGGLGGNSKVIPIQNWDQLHLSLPPGLQQ
KISNAKRQQKRELELEQRRRQRLKARKSQRKAHSEANTELRPQQEQLPLHLVTTGDQPIE
RQARLSEREEFDRWYRLAQQCKLVADYSWRDGEYWVLAEEQWQPYSELSAVFTLRAMERM
FGVSFDFGDGRDD
Download sequence
Identical sequences A8ZPS4
gi|158341201|ref|YP_001522435.1|NC_009931 gi|158341201|ref|YP_001522435.1| WP_012168194.1.67183 329726.AM1_F0131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]