SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158341283|ref|YP_001522353.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158341283|ref|YP_001522353.1|
Domain Number 1 Region: 358-801,832-900
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 9.16e-178
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000495
Further Details:      
 
Domain Number 2 Region: 146-357
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.28e-59
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158341283|ref|YP_001522353.1|
Sequence length 960
Comment ribonucleotide-diphosphate reductase subunit alpha [Acaryochloris marina MBIC11017]
Sequence
MPDTKELESAPLSILPPIQGGSVEGLDAEYKVIRRNGSVVGFEADKIAIAMTKAFLAVKG
VQSGVSARVRELVATLTTNVVTALKRRQPTGGTFHIEDIQDQVELALMRSGEHDVARAYV
LYREKRSQKRTQQHGIEAAPIYLMDGGDRVLLDLERFNDLVDSACINLGDTVSGKAIADE
ALKNIYDGASVVELHKSAILAARSHIEKDPDYSKVTARLLLHRIRQEVLGAEVTQAEMQA
RYAEYFPHFIQQGIATGLLDEKLAQFNLQKLGSVLVAERDLQFGYLGLQTLYDRYFLHTE
DRRIELPQAFFMRVAMGLALNEIDREERAAEFYDILSKFDFMSSTPTLFNSGTVRSQLSS
CYLTTVPDALDGIYSAIKDNALLSKYAGGLGNDWTPVRALGAHIKGTNGKSQGVVPFLKV
VNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDINTANWIPDLFM
KRVMEDGDWTLFSPDIVPDLHDKVGKEFETAYLAYEQQAAKGELKPFKTVPANTLWRKML
SMLFETGHPWITFKDPCNVRSPQQHIGMVHSSNLCTEVTLNTNENEIAVCNLGSVNLVNH
MVEKNGQMQLDQAKLQHTITIAMRMLDNVIDLNYYAVSTARNSNLKHRPVGLGIMGFQDC
LHQLRLPYASQDAVDFADRAMEAVCYYAYWASTELAQERGRYSTYKGSLWDRGILPQDTL
ALLKEVRGGFVEVDESSTMDWDLLRDRIAQHGMRNSNCVAIAPTATIANIIGVSACIEPT
YQNLYVKSNLSGEFTVVNEYLVRDLKVRELWDEVMIADLKYFDGSLAKIDRIPPELRQLY
ATAFEVEPNWIVEAAARRSKWIDQAQSLNIYMAGASGKKLDQIYKLAWQRGLKTTYYLRS
LGATHVEKSTAPASSLNAVSNNGSSNGIGNILTTSKSENLGQVCSLSPGDANFDDCEACQ
Download sequence
Identical sequences A8ZQ30
WP_012168121.1.67183 329726.AM1_F0047 gi|158341283|ref|YP_001522353.1|NC_009931 gi|158341283|ref|YP_001522353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]