SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158334241|ref|YP_001515413.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158334241|ref|YP_001515413.1|
Domain Number 1 Region: 70-199
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 4.84e-35
Family L,D-transpeptidase catalytic domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158334241|ref|YP_001515413.1|
Sequence length 201
Comment ErfK/YbiS/YcfS/YnhG family protein [Acaryochloris marina MBIC11017]
Sequence
MGNYCFNVSNASSAVLISPMKTEFIKIACVVISVGTIASFDVAQAAEQNIPETPLPGLDQ
PRNYLPSAHGTRRLELSISRRQVTLFQGDQVLKSYPVAVGKAGWPTPVGDFEVQTKVRNP
SWQNPFQGKGYVIPGGAPDNPLSTRWLGFWTNGKNWIGFHGTPNRASVGSAASHGCVRMY
DEHIQELFELVAVGTPVKVTR
Download sequence
Identical sequences B0C1T3
329726.AM1_1058 gi|158334241|ref|YP_001515413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]