SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158336799|ref|YP_001517973.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158336799|ref|YP_001517973.1|
Domain Number 1 Region: 124-250
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.92e-29
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 2-122
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.57e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158336799|ref|YP_001517973.1|
Sequence length 349
Comment succinate dehydrogenase iron-sulfur subunit [Acaryochloris marina MBIC11017]
Sequence
MQVLFKISRQQQQSAVKVQTYSLDVDPSTTILDCLNLIKWQQDGSLAFRKNCRNTICGSC
SMRINHRAALACQQNVKAEVARSYSAWNKQNGADSDRENPDSIPVIEIAPMGNMPVIKDL
VVEMDQFWQKLDQVEPYVSSASRQVPEREFLQSPEDRSKLDQMGNCILCGACYSDCNALP
ANGSFVGPHALAKAHRLLADTRDQATEHRLEQYNQDIQGVWGCTRCFNCNTVCPMGVAPL
DQISKIKSQVLANPTLPDSRPLRHRRVLVDLVQEGGWIDERKFGLKVVGNNFKDLPGLFS
LVPLAGQMLRRQKLPIKFDASTGTDEVRGLIEAVKKRQSKTASQSESTR
Download sequence
Identical sequences B0C3F8
gi|158336799|ref|YP_001517973.1| 329726.AM1_3667 WP_012164045.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]