SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339913|ref|YP_001521083.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339913|ref|YP_001521083.1|
Domain Number 1 Region: 8-134
Classification Level Classification E-value
Superfamily YjgF-like 5.34e-26
Family YjgF/L-PSP 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158339913|ref|YP_001521083.1|
Sequence length 135
Comment endoribonuclease L-PSP [Acaryochloris marina MBIC11017]
Sequence
MAPSLTYLNPASLPDASAFGYSQITIMEPGRLAFISGQVAWQSSGEAVPDSLTGQAELVV
KNAKAALDAVGASSEDIVMVRIYMVDLTPDRIEELMPHLLAMFDGAKPSLTGVGVAALAG
PELQLEIEMIARLPS
Download sequence
Identical sequences A8ZM00
gi|158339913|ref|YP_001521083.1| 329726.AM1_B0043 WP_012166923.1.67183 gi|158339913|ref|YP_001521083.1|NC_009927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]