SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158341184|ref|YP_001522453.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158341184|ref|YP_001522453.1|
Domain Number 1 Region: 320-447
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000000235
Family Apolipoprotein 0.018
Further Details:      
 
Weak hits

Sequence:  gi|158341184|ref|YP_001522453.1|
Domain Number - Region: 133-300
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00785
Family Apolipoprotein A-I 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158341184|ref|YP_001522453.1|
Sequence length 550
Comment hypothetical protein AM1_F0149 [Acaryochloris marina MBIC11017]
Sequence
MPIHQAAQNQTHEVQEANARAVEGSARMIAEAMRMSFRLMRMAQRNAQQLSQQYGSGASD
SDTPDPDTPDLDEDIELNPREENELSQEADIQLNPEQDITIKVGKTTVYPIPEDTQLEQA
DVDNLIAALENPEQLQEEVTVFATQTLPDGSKSNENVFHAVPGEVKYDPHKLVEAFAQQK
VEQQDETLSQDQEPAQIVIEGETRPMSWDTPVVNQAAAPIIENIKNKVTQGAEAIKDRAA
NALERQNLLNMAFKGGTVARAAYDQAAQIPGRAEKLKEVVAQVKEKTGQAIAEVREKAKD
LDPKQLIQGKDPVQGPELPSLDDRISTLQSQVGDLQWQMNDLQDQLKSVDAKLDVIVNRT
NPPEQSNNVDKWHNNLGGMVKEKLQQIKEKITTAIQSIKDKISEVINNFKATAFDKVEQA
KEKVTEVKDNVTSRVDNTVQSVRQGIADIQAGMTNAAVAKLVQQYGQEQPDGSRVYNGDR
FSYQTQGDSVTISAKGRGNVFQNGQLTDKANVQDAQAIQALPAKVEQEFAHQQSEKATAS
QAVGAGGRRR
Download sequence
Identical sequences A8ZPU2
gi|158341184|ref|YP_001522453.1| WP_012168212.1.67183 329726.AM1_F0149 gi|158341184|ref|YP_001522453.1|NC_009931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]