SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167036818|ref|YP_001664396.1| from Thermoanaerobacter pseudethanolicus ATCC 33223

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167036818|ref|YP_001664396.1|
Domain Number 1 Region: 81-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-27
Family Translational machinery components 0.00016
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.38e-21
Family Ribosomal S5 protein, N-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167036818|ref|YP_001664396.1|
Sequence length 167
Comment 30S ribosomal protein S5 [Thermoanaerobacter pseudethanolicus ATCC 33223]
Sequence
MARVDWTKLDLKERVVSINRVSKVVKGGKNFRFSVTVVVGDAERGYVGVGRGKAAEIPDA
IRKAIEDAKKHLIKVPIVGTTIPHEVIGEFGAGKVLLKPAREGTGVIAGGPVRAVLESAG
IKDVLTKSLGSSNATNMVYATIEGLKRLRTAEDVAKLRGIPVSQLFE
Download sequence
Identical sequences B0K5R0 B0KCL7 C7IUS8 E8UV01
gi|307725136|ref|YP_003904887.1| gi|320115240|ref|YP_004185399.1| gi|167039537|ref|YP_001662522.1| WP_003868577.1.26562 WP_003868577.1.2934 WP_003868577.1.47445 WP_003868577.1.56562 WP_003868577.1.81593 WP_003868577.1.95568 gi|167036818|ref|YP_001664396.1| 340099.Teth39_0391 399726.Teth514_0884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]