SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|183220323|ref|YP_001838319.1| from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183220323|ref|YP_001838319.1|
Domain Number 1 Region: 159-340
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.22e-59
Family Methylesterase CheB, C-terminal domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 1-130
Classification Level Classification E-value
Superfamily CheY-like 9.82e-30
Family CheY-related 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|183220323|ref|YP_001838319.1|
Sequence length 347
Comment chemotaxis response regulator CheB [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Sequence
MKKNKVIIVDDQRTVRGMIKRWIESDPNWEVVGEASNPFEARDQIIEKQPDVMTLDVHMP
EMDGIEFLKKLLPQHPMPVIMFSSSTTEGTAITLEALDAGAFDYVTKPSGTPESLIEAKE
DLLSKLHAALNYNVSLYQNTKSTTPSKILSAKRHTSFKTKVIVIGSSTGGTTALRKLLDD
VDESFPPILVAQHMPENFTALFAGRLNAELKVKVIEAKDKQLLENGTVYIAPGNFHLEIQ
KLNGELYTKITQFEKVNGHRPSVDVLFDSVVNCGIANQTISIILTGMGSDGAKGLLNLKN
NGSITLGQNKETCVVYGMPKVAFEIGAVMYQLPLESIADKTREIGSK
Download sequence
Identical sequences B0SLZ1
355278.LBF_0886 456481.LEPBI_I0919 gi|183220323|ref|YP_001838319.1| gi|189910440|ref|YP_001961995.1| WP_012387926.1.33202 WP_012387926.1.95533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]