SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|183220966|ref|YP_001838962.1| from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183220966|ref|YP_001838962.1|
Domain Number 1 Region: 163-348
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.89e-70
Family Methylesterase CheB, C-terminal domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 3.42e-26
Family CheY-related 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|183220966|ref|YP_001838962.1|
Sequence length 350
Comment protein-glutamate methylesterase CheB [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Sequence
MNRIKVFVIDDSAVVRQVLTEIFKQDSHFLFLGSASDPIFAMEKMNNDWPDVIVLDIEMP
RMDGLSFLKKIMTERPTPVVICSTLTTEGSETAILAMNLGACDIITKPKIGLKDFLNEST
MALTDAVIAAASASMKHLPNPTKTTEFKIQLEKKQELSSLQATEKIIAIGTSTGGTIALE
QVLTKLPRDKTPGIVIVQHMPEKFTEAFAKRLDSICEIRVKEAKDGDRVVRGLALIAPGN
KHMTLKRSGAQYYVEVMDGPLVNRHKPSVDVLFRSVAKHAGKNARGIIMTGMGDDGALGL
LEMKEAGAETIAQNEETSVVFGMPKEAIKRGCVDHILPLGEIYKTIVGFG
Download sequence
Identical sequences B0SQY5
355278.LBF_1528 456481.LEPBI_I1579 WP_012388565.1.33202 WP_012388565.1.95533 gi|183220966|ref|YP_001838962.1| gi|189911061|ref|YP_001962616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]