SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|183221761|ref|YP_001839757.1| from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183221761|ref|YP_001839757.1|
Domain Number 1 Region: 163-352
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.01e-59
Family Methylesterase CheB, C-terminal domain 0.00000902
Further Details:      
 
Domain Number 2 Region: 4-118
Classification Level Classification E-value
Superfamily CheY-like 8.4e-25
Family CheY-related 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|183221761|ref|YP_001839757.1|
Sequence length 355
Comment chemotaxis response regulator protein-glutamate methylesterase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Sequence
MNKKPTVVIIDDSLLVRNILSDALTKKEEISVIATGKTGMDCIDLAEKLKPDFIVLDIEM
PIMDGLTALAEIKKKKLPSHVIMLSVLTQHGADATFKALELGAVDFIPKPSSGNQFSPED
IAAVLSLKIKGFSDSKLVSLEPILRPERTDRQINKSFQKPIQVDAIGIGTSTGGPKALQT
VFAGIPADFPKPIFVVQHMPAGFTKAFADRLNTLSKIQVKEAEQGDLVNSGTAYIAPGDY
QMKVVSKGKDRFIELTHSEQVNGHRPSIEVLFDSLVESYGADHLLSMIMTGMGKDRSHAI
SNIHAKGGITLAQNEATSVVYGMNRVAVELGGIDFVLPVEELVPKMIELLKSRGN
Download sequence
Identical sequences B0SKY8
WP_012389344.1.33202 WP_012389344.1.95533 gi|189911836|ref|YP_001963391.1| 355278.LBF_2323 456481.LEPBI_I2391 gi|183221761|ref|YP_001839757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]