SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|183220240|ref|YP_001838236.1| from Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183220240|ref|YP_001838236.1|
Domain Number 1 Region: 238-527
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.09e-61
Family DNA repair protein MutS, domain III 0.0000272
Further Details:      
 
Domain Number 2 Region: 534-767
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.81e-55
Family ABC transporter ATPase domain-like 0.00000161
Further Details:      
 
Domain Number 3 Region: 3-106
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 4.71e-37
Family DNA repair protein MutS, domain I 0.0000323
Further Details:      
 
Domain Number 4 Region: 108-250
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 2.49e-18
Family DNA repair protein MutS, domain II 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|183220240|ref|YP_001838236.1|
Sequence length 833
Comment DNA mismatch repair protein MutS [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Sequence
MNTPVMRQYLEVKELHPDGIVFFRMGDFYEMFLDDAKIAAQILDITLTKRQNQIPMAGIP
YHATESYISRLISAGKKVVVCEQTKPDDPKAKIMSREVVRIITPGTVVEDNLLGGYQNNY
LSLYYKEKTSVYLAFADVSTSELVYFFFSESEKERILDTIKRFSPKEMIYTDDIPPLSKE
SKIILTQIPKEYVPKKKGAGIDTVVHVLDAYLQYNYRNQNFVFKSPRRIDETEYLILDEQ
TVSHLELVENPNDKNHTLFGVLNRCLTATGKRYLKQRILFPTRDENKIKDHWDKIEILTQ
NKKERLKIKESLGDLIDLERVITRFRVGKALPRDFRGIEKSLTAVTLMKAVLDGIGYDFS
KLPNDLESLVLEFQNTLFDGELPVFLGNSPFLKSGFHKEYDEAILAREKGKDWILELEEK
EKKESGCSSLKIRYNKILGYFIEVSKAQAKDVPSHFLKKQTLVTGERFTSPKLEELERAI
LQADEIIERIEKQFFDRLVATCISLYEAFLTLSNEVASLDYHLSLTEIKEEYQWIRPEIR
NDGIIEYMDSRHPVVETFLPIGERFVPNHLELNPKENAIAVLTGPNMAGKSTFMRQIAIN
QILFQMGSYVPAKKASLSIVDRIFTRIGSGDNLTKGESTFYVEMRETATILNQFTENSLI
LFDEVGRGTSTYDGLSIAWAILEFLSKNFPKPKTIFATHYHELTELEKGAGIFNLYLDTF
EKDGEILFLKKVKRGKSKQSFGIYVAKLAGIPETVSERAKEILVGLESKKREIKIKNEEP
SLFGNILEKEPNGLSANEEKVIKRISQIDPNKIPPLEALSILDELKRILQEEN
Download sequence
Identical sequences B0SLQ8
456481.LEPBI_I0833 gi|183220240|ref|YP_001838236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]