SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|512616131|ref|YP_008100815.1| from Pseudomonas resinovorans NBRC 106553

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|512616131|ref|YP_008100815.1|
Domain Number - Region: 19-91
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00405
Family Phase 1 flagellin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512616131|ref|YP_008100815.1|
Sequence length 93
Comment hypothetical protein PCA10_04780 [Pseudomonas resinovorans NBRC 106553]
Sequence
MPGIVNRALVIAMEIQGSGFSAGLGAIQSGQRMIQKAAGEIASNTVAGTEGQQPADLTSI
LLALQAGKIQAEAGSQVAKATDQMIGSLIDTFA
Download sequence
Identical sequences S6AF00
gi|512616131|ref|YP_008100815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]