SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512618127|ref|YP_008102811.1| from Pseudomonas resinovorans NBRC 106553

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512618127|ref|YP_008102811.1|
Domain Number 1 Region: 25-212
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.97e-28
Family Clp protease, ClpP subunit 0.034
Further Details:      
 
Domain Number 2 Region: 385-451
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000157
Family NfeD domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512618127|ref|YP_008102811.1|
Sequence length 460
Comment putative S49 family peptidase [Pseudomonas resinovorans NBRC 106553]
Sequence
MIRWLLGRLLCLALLAPGPLLAAASVTVLTVDGPIGPATADYLTRGIQRAEADKAQLVVI
QIDTPGGLDTSMRSIIKAILASPVPVASFVAPSGARAASAGTYILYASHIAAMAPGTNLG
AATPVQIGGMPGQPQGDKPAADKDEKSKDDKAKPADDQETLTRKQVNDAAAYIRGLAQMR
GRNATWAERAVRESVSLSASDAQHLKVVDLLARDIPDLLRQLDGRTLEVAGQKITLATAG
APLVQREPDWRARILAVIANPSVALILMMIGVYGLIFEFSNPGSAVGGVVGGICLILALY
ALQLMPVNFAGVALILLGILFMVAEAFMPSFGIIGFGGIAAFVVGAVILIDTDVPGYGIP
LALIITIALASALVIFAILAMALRARRKALVSGDAGLVGSEATLLEQTLDDPRSGWVQLQ
GERWQVRSAQPLKSGQRVRVLARNGLMLDVTADDRPPQGD
Download sequence
Identical sequences S6AUY7
WP_016492401.1.19175 gi|512618127|ref|YP_008102811.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]