SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512619705|ref|YP_008104389.1| from Pseudomonas resinovorans NBRC 106553

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512619705|ref|YP_008104389.1|
Domain Number 1 Region: 3-129
Classification Level Classification E-value
Superfamily FlgN-like 5.62e-31
Family FlgN-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|512619705|ref|YP_008104389.1|
Sequence length 155
Comment hypothetical protein PCA10_40520 [Pseudomonas resinovorans NBRC 106553]
Sequence
MQDTTLLQLFTDDIGHAQRLLELMDEEFQALGERDLPRLEKLLADKQPLLAQLDQHGQQR
SQLLASLQLSTDRAGLQRLAERSPLGQELLARGDELGQLLESCQQLNERNGRLIRANRAS
VGGMLGILRGGDTPSLYDSRGAAARIGQQRPLSQA
Download sequence
Identical sequences S6BKL5
WP_016493918.1.19175 gi|512619705|ref|YP_008104389.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]